<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
14INT-E 14INT-E Germany 2006 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI+PI NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    L2I, S39C, I72V, L101I, T124TA, G193E, V201I, I208M, T218I, S230N, L234I, A265V  
>14INT-E| codons 1-270
FIDGIDKAQEEHEKYHSNWRAMASDFNLPPVVAKEIVACCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKTIHTDNGSN
FTSATVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGEYSAGERIIDIIATDMQTKELQKQIIKIQNFRVYYRDNRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKVKIIRD

References
Author Title Citation
Sichtig, N Evolution of raltegravir resistance during therapy. J Antimicrob Chemother, 2009