<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-E 12-E Germany 2005 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI+PI NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    K7R, K14KR, L28I, S39C, L45LI, T124A, K188KR, V201VI, T218TS, I220M, Y227F, S230N, A265V  
>12-E| codons 1-270
FLDGIDRAQEEHERYHSNWRAMASDFNIPPVVAKEIVACCDKCQIKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSN
FTSATVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRRGGIGGYSAGERIIDIIATDIQTKELQKQISKMQNFRVYFRDNRDPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKVKIIRD

References
Author Title Citation
Sichtig, N Evolution of raltegravir resistance during therapy. J Antimicrob Chemother, 2009