<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
16-E 16-E Germany 2005 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI+PI NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    D3DE, K7KQ, R20K, V31I, I72V, L74I, T112V, I113IV, S119P, T124S, T125A, G134N, K136Q, D167E, V201I, T218I, L234I, S255N  
>16-E| codons 1-270
FLEGIDQAQEEHEKYHSNWKAMASDFNLPPIVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVIIVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKVVHTDNGPN
FTSSAVKAACWWANIQQEFGIPYNPQSQGVVESMNKELKKIIGQVREQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTKELQKQIIKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNNDIKVVPRRKAKIIRD

References
Author Title Citation
Sichtig, N Evolution of raltegravir resistance during therapy. J Antimicrob Chemother, 2009