<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SP_B_059 RU_SP_B_059 Russia 2006 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+IDV 8
2 Unknown NA
3 D4T+DDI+NVP NA
4 Unknown NA
5 3TC+AZT+LPV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    G17GE, K20R, E35D, M36I, R41K, R57K, L89M  
>RU_SP_B_059| codons 1-99
PQITLWQRPLVTIKIGEQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K32KR, V35K, D123DE, S162C, K173T, Q174K, T200I, Q207E, R211K, F214L, V245Q, E248D, D250E, A272P, T286A, E291D, V292I, I293V, E297T  
>RU_SP_B_059| codons 1-301
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIRALKEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRTKNPDIVI
YQYMDDLYVGSDLEIGQHRIKIEELREHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVPLTTEAE
L

References
Author Title Citation
Thomson, MM Molecular epidemiology of HIV-1 in St Petersburg, Russia: Predominance of subtype A, former Soviet Union variant, and identification of intrasubtype subclusters. JAIDS, 2009