<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SP_B_053 RU_SP_B_053 Russia 2006 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T+DDI NA
2 3TC+ABC+LPV 24

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L33V, N37Y, I62V, L63P, I64L, H69Q  
>RU_SP_B_053| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVVEEMYLPGRWKPKMIGGIGGFIKVRQYD
QVPLEICGQKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E28A, V35I, K122E, D177E, Q207E, A272AP, T286A, I293V, E297A  
>RU_SP_B_053| codons 1-301
PISPIETVPVKLKPGMDGPKVKQWPLTAEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEVVPLTAEAE
L

References
Author Title Citation
Thomson, MM Molecular epidemiology of HIV-1 in St Petersburg, Russia: Predominance of subtype A, former Soviet Union variant, and identification of intrasubtype subclusters. JAIDS, 2009