<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SP_B_042 RU_SP_B_042 Russia 2006 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K11T, T27S, V35T, E36ED, T39E, V60I, S68G, K122E, D123S, I135T, K173L, Q174K, D177EG, Q207A, R211S, E248D, A272P, T286A, E291D, V292I, I293V, P294T  
>RU_SP_B_042| codons 1-301
PISPIETVPVTLKPGMDGPKVKQWPLSEEKIKALTDICEEMEKEGKISKIGPENPYNTPI
FAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRLKNPGIVI
YQYMDDLYVGSDLEIGQHRTKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVTLTEEAE
L

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, E35D, M36I, R41K, C67Y, H69K, L89M  
>RU_SP_B_042| codons 1-99
PQITLWQRPIVTVKIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEIYGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Thomson, MM Molecular epidemiology of HIV-1 in St Petersburg, Russia: Predominance of subtype A, former Soviet Union variant, and identification of intrasubtype subclusters. JAIDS, 2009