<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SP_B_007 RU_SP_B_007 Russia 2006 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+NVP 203

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V D67DG V106A F227FL I31L, K122E, D123E, S162C, D177E, I202V, V245M, K277R, A288S, I293V, E297K  
>RU_SP_B_007| codons 1-301
PISPIETVPVKLKPGMDGPKVKQWPLTEEKLKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKGSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSATVLDVGDAYFSVPL
DEEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPEIVI
YQYVDDLYVGSDLEIGQHRTKVEELRQHLLRWGFTTPDKKHQKEPPLLWMGYELHPDKWT
VQPIMLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGTKSLTEVVPLTKEAE
L

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L63LP  
>RU_SP_B_007| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Thomson, MM Molecular epidemiology of HIV-1 in St Petersburg, Russia: Predominance of subtype A, former Soviet Union variant, and identification of intrasubtype subclusters. JAIDS, 2009