<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SP_B_001 RU_SP_B_001 Russia 2006 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC|AZT|D4T|EFV|IDV|NVP|RTV 216

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46L, V82A K43T L10I, N37Y, L63S, A71V  
>RU_SP_B_001| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTILEEMYLPGRWTPKLIGGIGGFIKVRQYD
QISIEICGHKVIGTVLVGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y   K103N   K122E, D123E, T200E, V245K, K277R, T286A, A288S, I293V, E297R  
>RU_SP_B_001| codons 1-301
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DEEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHREKIEELRQHLWRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGAKSLTEVVPLTREAE
L

References
Author Title Citation
Thomson, MM Molecular epidemiology of HIV-1 in St Petersburg, Russia: Predominance of subtype A, former Soviet Union variant, and identification of intrasubtype subclusters. JAIDS, 2009