<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5271 CA12930 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI 187
2 None 4
3 3TC+AZT 4
4 3TC+AZT+RTV 30
5 3TC+AZT+IDV 113
6 None 12
7 3TC+AZT+IDV 30
8 None 6

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, L74V, T215F T69G, K219Q     D67X, A98S, I135V, D192E, R211K, L228H, V245T, K277R, L283I, I293V  
>CA12930| codons 1-304
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKXSGRWRKVVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSELEIGQHRTKIEELRQHLLKWGFFTPDQKHQKEPPFHWMGYELHPDKWT
VQPITLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLIRGTKALTEVVPLTEEAE
LELA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L63P, K70KR  
>CA12979| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHRAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005