<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4334 CA12916 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 26
2 3TC+D4T+IDV 52
3 DDI+DLV+RTV+SQV 52
4 D4T+ADV+EFV+RTV+SQV 21
5 None 26
6 ABC+D4T+APV+NFV 21

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, I84V, L90LM L33LI L10LI, L19LI, K20X, E35D, M36MI, N37D, L63P, A71IT, Q92QK  
>CA12916| codons 1-99
PQITLWQRPIVTIKIGGQIXEALLDTGADDTVIEDIDLPGRWKPKMIGGIGGFVKVRQYD
QIPIEICGHKIIGTVLVGPTPVNVIGRNLMTKIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67DN, L74V, L210W, T215Y K219N Y181C, G190GA V179D T39E, R83K, K103R, K122E, S162C, G196GE, E203D, R211K, V245Q, A272AP, T286A, V292I  
>CA12834| codons 1-303
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICEELEKEGKISKIGPENPYNTPV
FAIKKKNSTKWRKVVDFRELNKKTQDFWEVQLGIPHPAGLKKRKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIDI
CQYMDDLYVASDLEIEQHRTKIDELRQHLWKWGFYTPDNKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEIIPLTEEAE
LEL

References
Author Title Citation
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005