<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5240 CA12915 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+NFV 9
2 3TC+AZT+NFV+NVP 16

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N   I13V, I15V, G16E, M36MV, L63T, I64V  
>CA12915| codons 11-99
VTVKVEGQLKEALLDTGADNTVLEEVNLPGRWKPKMIGGIGGFIKVRQYDQITVEICGHK
AIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215Y   Y188L   T39S, E44D, A98S, A158S, S162A, R211K, V245T, I257L, I293V, T296S  
>CA12833| codons 1-302
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICSELEKDGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPSIFQASMTKILEPFRKQNPDIVI
YQYVDDLLVGSDLEIGQHRTKIEELRQHLLKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPITLPEKDSWTVNDLQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLSEEAE
LE

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009