<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TC53 TC53_2003 Zimbabwe 2003 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP 13
2 3TC+AZT+EFV 9
3 3TC+AZT+NFV 8

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    M36I, R41K, D60E, L63P, H69K, L89M, I93L  
>TC53_2003| codons 27-99
GADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYEQIPIEICGKKAIGTVLVGPTPVNIIG
RNMLTQLGCTLNF

References
Author Title Citation
Kassaye, S Envelope coreceptor tropism, drug resistance, and viral evolution among subtype C HIV-1-infected individuals receiving nonsuppressive antiretroviral therapy. JAIDS, 2009