<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TCDD-08 TC08_2004 Zimbabwe 2004 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+SQV 239
2 3TC+D4T+EFV 22

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, L19I, M36I, R41K, D60E, L63T, H69K, I72T, T74S, L89M, I93L  
>TC08_2004| codons 1-99
PQITLWQRPLVTIKVGGQIKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYE
QITIEICGKKATGSVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V, T215F   M230L V179D V8I, K20R, V35K, T39E, S48T, V60I, K103R, K173T, D177E, T200A, Q207E  
>TC08_2004| codons 1-243
PISPIETIPVKLKPGMDGPRVKQWPLTEEKIKALKEICEEMEKEGKITKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKRKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTQNPEIDI
YQYVDDLYVGSDLEIGQHRAKIEELREHLLRWGFFTPDKKHQKEPPFLWLGYELHPDKWT
VQP

References
Author Title Citation
Kassaye, S Envelope coreceptor tropism, drug resistance, and viral evolution among subtype C HIV-1-infected individuals receiving nonsuppressive antiretroviral therapy. JAIDS, 2009