<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TCDD-23 TC23_2003 Zimbabwe 2003 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 SQV+ DDC+ AZT 304

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T69T_T, K70R D67G, K219Q     V35T, T39E, S48T, V60I, K64N, K103KR, V118I, K122E, D123S, E138A, T139A, K173T, Q174K, T200A, I202V, E203K, Q207E, R211K, F214L, D218E, L228HR, V245E, E248D  
>TC23_2003| codons 1-253
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICEEMEKEGKITKIGPENPYNTPI
FAINKKGSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKRKSVTVLDVGDAYFSIPL
DESFRKYTAFTIPSINNAAPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTKNPDIVI
YQYMDDLYVGSDLEIGQHRAKVKELREHLLKWGLTTPEQKHQKEPPFRWMGYELHPDKWT
VQPIELPDKDSWT

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   I15V, L19I, K20M, M36I, R41K, D60E, L63P, H69Q, V82I, L89M, I93L  
>TC23_2003| codons 1-99
PQITLWQRPLVTIKVGGQIMEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYE
QIPIEICGQKAIGTVLVGPTPINIIGRNMMTQLGCTLNF

References
Author Title Citation
Kassaye, S Envelope coreceptor tropism, drug resistance, and viral evolution among subtype C HIV-1-infected individuals receiving nonsuppressive antiretroviral therapy. JAIDS, 2009
Johnston, E High frequency of syncytium-inducing and CXCR4-tropic viruses among human immunodeficiency virus type 1 subtype C-infected patients receiving antiretroviral treatment. J Virol, 2003