<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TC-68 TC68_2003 Zimbabwe 2003 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP 21

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, L19I, M36I, N37S, R41K, I64L, H69K, V82I, L89M, I93L  
>TC68_2003| codons 1-99
PQITLWQRPLVTIKVGGQIKEALLDTGADDTVLEEISLPGKWKPKMIGGIGGFIKVRQYD
QILLEICGKKAIGTVLVGPTPINIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    V106VM K238KN K22R, V35T, E36A, T39E, E40D, S48ST, T69A, W88C, K122E, D123NS, S162H, K173A, D177E, E203Q, Q207E, R211K, V245Q H198HL
>TC68_2003| codons 1-253
PISPIETVPVKLKPGMDGPKVRQWPLTEEKIKALTAICEDMEKEGKITKIGPENPYNTPV
FAIKKKDSAKWRKLVDFRELNKRTQDFCEVQLGIPHPAGLKKKKSMTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQHSMTKILEPFRAQNPEIVI
YQYMDDLYVGSDLEIGQLRTKIQELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDNWT
VQPIQLPEKDSWT

References
Author Title Citation
Kassaye, S Envelope coreceptor tropism, drug resistance, and viral evolution among subtype C HIV-1-infected individuals receiving nonsuppressive antiretroviral therapy. JAIDS, 2009
Johnston, E High frequency of syncytium-inducing and CXCR4-tropic viruses among human immunodeficiency virus type 1 subtype C-infected patients receiving antiretroviral treatment. J Virol, 2003