<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TCDD-30 TC30_2003 Zimbabwe 2003 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ NFV+ 3TC 4
2 3TC+ AZT+ IDV 95
3 NVP+ 3TC+ D4T 12

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, T215F K219Q Y181C   V35T, T39E, S48T, E53D, V60I, K122E, D123S, K173T, D177E, I178L, T200A, Q207A, R211K, L228R, V245Q  
>TC30_2003| codons 1-253
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICEELEKEGKITKIGPDNPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTQNPELVI
CQYMDDLYVGSDLEIGQHRAKIEELRAHLLKWGFFTPDQKHQKEPPFRWMGYELHPDKWT
VQPIQLPEKDSWT

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, I84V   L10I, T12A, I15V, L19I, K20KR, E35D, M36I, R41K, L63P, H69Q, L89M, I93L  
>TC30_2003| codons 1-99
PQITLWQRPIVAIKVGGQIREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFVKVRQYD
QIPIEICGQKAIGTVLVGPTPVNVIGRNMLTQLGCTLNF

References
Author Title Citation
Kassaye, S Envelope coreceptor tropism, drug resistance, and viral evolution among subtype C HIV-1-infected individuals receiving nonsuppressive antiretroviral therapy. JAIDS, 2009
Johnston, E High frequency of syncytium-inducing and CXCR4-tropic viruses among human immunodeficiency virus type 1 subtype C-infected patients receiving antiretroviral treatment. J Virol, 2003