<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TCDD-28 TC28_2004 Zimbabwe 2004 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+SQV 361
2 3TC+D4T+NVP 57
3 LPV+TDF 17

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V, L90M G73S I15V, L19I, K20I, M36I, L63P, H69K, A71V, I93L  
>TC28_2004| codons 1-99
PQITLWQRPLVTIKVGGQIIEALLDTGADDTVLEEINLPGRWKPKIIGGIGGFIKVRQYD
QIPIEICGKKVISTVLVGPTPVNVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, T215F K219Q K101E, Y181C, G190A   V35T, T39E, S48T, V60I, T69N, K122E, D123G, I135T, E138A, I167V, K173A, Q174K, N175Y, T200A, I202V, Q207A, H221Y  
>TC28_2004| codons 1-243
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICEEMEKEGKITKIGPENPYNTPI
FAIKKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSVPL
DEGFRKYTAFTIPSTNNATPGIRYQYNVLPQGWKGSPAIFQSSMTKVLEPFRAKYPDIVI
CQYMDDLYVASDLEIGQHRAKVEELRAHLLRWGFFTPDQKYQKEPPFLWMGYELHPDKWT
VQP

References
Author Title Citation
Kassaye, S Envelope coreceptor tropism, drug resistance, and viral evolution among subtype C HIV-1-infected individuals receiving nonsuppressive antiretroviral therapy. JAIDS, 2009