<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TCDD-28 TC28_2003 Zimbabwe 2003 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+SQV 361
2 3TC+D4T+NVP 21

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V T215V, K219Q Y181C   V35T, T39E, S48T, V60I, T69N, K122E, D123G, I135T, E138A, I142V, I167IV, K173A, N175Y, G190X, T200A, I202V, Q207A, V245Q, D250E  
>TC28_2003| codons 1-253
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICEEMEKEGKITKIGPENPYNTPI
FAIKKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEGFRKYTAFTIPSTNNATPGVRYQYNVLPQGWKGSPAIFQSSMTKVLEPFRAQYPDIVI
CQYVDDLYVXSDLEIGQHRAKVEELRAHLLRWGFVTPDQKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKESWT

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M G73S I15V, L19I, K20I, M36I, L63P, H69K, A71V, I93L  
>TC28_2003| codons 1-99
PQITLWQRPLVTIKVGGQIIEALLDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGKKVISTVLVGPTPVNIIGRNLMTQLGCTLNF

References
Author Title Citation
Kassaye, S Envelope coreceptor tropism, drug resistance, and viral evolution among subtype C HIV-1-infected individuals receiving nonsuppressive antiretroviral therapy. JAIDS, 2009
Johnston, E High frequency of syncytium-inducing and CXCR4-tropic viruses among human immunodeficiency virus type 1 subtype C-infected patients receiving antiretroviral treatment. J Virol, 2003