<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TCDD-31 TC31_2003 Zimbabwe 2003 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 D4T+ 3TC+ SQV 43
2 APV+ NVP+ DDI 130
3 EFV+ IDV+ LPV 25

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, L76V V32VG, I47IM D60DE, L63P, H69K, T74A, I85V, L89M, I93L R41R*K
>TC31_2003| codons 29-99
DDTGLEEMNLPGKWKPKIMGGIGGFIKVRQYEQIPIEICGKKAIGAVVVGPTPVNIVGRN
MLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, T215Y   K103N, Y181C, G190A   S3C, E6D, V35T, T39E, K122E, D123S, I142V, S163I, T165L, K173T, Q174K, D177E, T200A, E203D, Q207E, H208Y, R211K, V245Q, E248D  
>TC31_2003| codons 1-253
PICPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALTEICEELEKEGKISKIGPENPYNTPV
FAIKKKNSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSIMLKILEPFRTKNPEIVI
CQYMDDLYVASDLEIGQHRAKIDELREYLLKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKDSWT

References
Author Title Citation
Kassaye, S Envelope coreceptor tropism, drug resistance, and viral evolution among subtype C HIV-1-infected individuals receiving nonsuppressive antiretroviral therapy. JAIDS, 2009
Johnston, E High frequency of syncytium-inducing and CXCR4-tropic viruses among human immunodeficiency virus type 1 subtype C-infected patients receiving antiretroviral treatment. J Virol, 2003