<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TC-47 TC47_2004 Zimbabwe 2004 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 D4T+DDI+NVP 52
2 3TC+D4T+NVP 30

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, L19T, M36I, R41K, I62V, L63S, H69K, A71T, I72E, I93L  
>TC47_2004| codons 1-99
PQITLWQRPLVTIKVGGQTKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QVSIEICGKKTEGTVLVGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Q151M, M184V F116Y K103N, Y181C   K20R, V35T, E36A, T39E, E40D, S48T, S68G, K122E, D123E, S162A, K173A, Q174K, D177E, I178L, T200A, Q207E, R211K, F214L, H221HY, Q242QH  
>TC47_2004| codons 1-242
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTAICEDMEKEGKITKIGPENPYNTPV
FAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYYSVPL
DEEFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSPAIFQASMTKILEPFRAKNPELVI
CQYVDDLYVGSDLEIGQHRAKIEELREHLLKWGLTTPDKKYQKEPPFLWMGYELHPDKWT
VH

References
Author Title Citation
Kassaye, S Envelope coreceptor tropism, drug resistance, and viral evolution among subtype C HIV-1-infected individuals receiving nonsuppressive antiretroviral therapy. JAIDS, 2009