<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TC-47 TC47_2003 Zimbabwe 2003 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 D4T+DDI+NVP 21

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, L19IT, M36I, R41K, I62V, L63S, H69K, A71T, I72E, L89M, I93L  
>TC47_2003| codons 1-99
PQITLWQRPLVTIKVGGQTKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QVSIEICGKKTEGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Q151QKLM   K103KN, V106VM, Y181YC   K20R, V35T, E36A, T39E, E40D, S48T, S68SG, K122E, S162A, K173A, Q174K, D177E, T200A, E203EK, Q207E, R211RK, F214FL, V245Q, E248D D123EGKR
>TC47_2003| codons 1-253
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTAICEDMEKEGKITKIGPENPYNTPV
FAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSMTVLDVGDAYFSVPL
DERFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSPAIFQASMTKILEPFRAKNPEIVI
CQYMDDLYVGSDLEIGQHRAKIKELREHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKDSWT

References
Author Title Citation
Kassaye, S Envelope coreceptor tropism, drug resistance, and viral evolution among subtype C HIV-1-infected individuals receiving nonsuppressive antiretroviral therapy. JAIDS, 2009
Johnston, E High frequency of syncytium-inducing and CXCR4-tropic viruses among human immunodeficiency virus type 1 subtype C-infected patients receiving antiretroviral treatment. J Virol, 2003