<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TCDD-05 TC05_2003 Zimbabwe 2003 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 D4T 2
2 3TC+ SQV 20
3 3TC+ D4T+ SQV 127

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   T12S, I15V, L19I, E35D, M36I, R41K, L63P, H69K, A71V, I93L W6W*, P9PR
>TC05_2003| codons 1-99
PQITL*QRRLVSIKVGGQIKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGKKVIGTVLVGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       V35T, T39E, S48T, E53ED, K122E, D123S, I135L, S162A, K173T, Q174R, T200A, Q207D, R211K, V245Q  
>TC05_2003| codons 1-253
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICEEMEKEGKITKIGPDNPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTRNPDIVI
YQYVDDLYVGSDLEIGQHRAKIEELRDHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWT

References
Author Title Citation
Kassaye, S Envelope coreceptor tropism, drug resistance, and viral evolution among subtype C HIV-1-infected individuals receiving nonsuppressive antiretroviral therapy. JAIDS, 2009
Johnston, E High frequency of syncytium-inducing and CXCR4-tropic viruses among human immunodeficiency virus type 1 subtype C-infected patients receiving antiretroviral treatment. J Virol, 2003