<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TCDD-35 TC35_2004 Zimbabwe 2004 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDC+NFV 65
2 3TC+AZT+IDV 18
3 3TC+AZT+NFV 60
4 D4T+DDI+NVP 109

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  I54IF T12S, I13IL, I15V, L19I, M36I, R41K, D60E, Q61E, L63P, H69K, I93L  
>TC35_2004| codons 1-99
PQITLWQRPLVSLKVGGQIKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFFKVRQYE
EIPIEICGKKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, K65R, K70R, V75T, Q151M, T215Y A62V, K219E Y181C, G190A   K20KR, T27S, V35T, E36A, T39E, E53D, S68G, K122E, D123S, S162Y, K166R, R172K, K173A, Q174K, D177E, I178L, T200A, E203K, Q207E, R211K, F214FL, D218DN, K223E, L228H  
>TC35_2004| codons 1-243
PISPIETVPVKLKPGMDGPRVKQWPLSEEKIKALTAICEELEKEGKISKIGPDNPYNTPV
FVIKRKDGTRWRKLTDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSPAIFQYSMTRILEPFKAKNPELVI
CQYMDDLYVASDLEIGQHRAKIKELREHLLKWGLYTPNEKHQEEPPFHWMGYELHPDKWT
VQP

References
Author Title Citation
Kassaye, S Envelope coreceptor tropism, drug resistance, and viral evolution among subtype C HIV-1-infected individuals receiving nonsuppressive antiretroviral therapy. JAIDS, 2009