<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TCDD-35 TC35_2003 Zimbabwe 2003 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDC+NFV 65
2 3TC+AZT+IDV 18
3 3TC+AZT+NFV 60
4 D4T+DDI+NVP 52

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19I, K20I, M36I, R41K, D60E, Q61E, L63P, H69K, I93L  
>TC35_2003| codons 1-99
PQITLWQRPLVSIKVGGQIIEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYE
EIPIEICGKKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, Q151M, M184V, T215FY K219E Y181C, G190A   T27S, V35T, E36A, T39E, E53D, V60I, K122E, D123S, S162Y, K166R, K173A, Q174K, D177E, I178L, T200A, E203EK, Q207E, R211K, K223KE, L228H, V245Q R172I
>TC35_2003| codons 1-253
PISPIETVPVKLKPGMDGPKVKQWPLSEEKIKALTAICEELEKEGKISKIGPDNPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSPAIFQYSMTRILEPFIAKNPELVI
CQYVDDLYVASDLEIGQHRAKIKELREHLLKWGFYTPDEKHQEEPPFHWMGYELHPDKWT
VQPIQLPEKDSWT

References
Author Title Citation
Kassaye, S Envelope coreceptor tropism, drug resistance, and viral evolution among subtype C HIV-1-infected individuals receiving nonsuppressive antiretroviral therapy. JAIDS, 2009
Johnston, E High frequency of syncytium-inducing and CXCR4-tropic viruses among human immunodeficiency virus type 1 subtype C-infected patients receiving antiretroviral treatment. J Virol, 2003