<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TC12 TC12_2004 Zimbabwe 2004 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 DDI 135
2 3TC+DDI 39
3 Unknown 35
4 APV+EFV+IDV 26
5 3TC+D4T+NVP 69

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215Y   K103N   V35R, E36EA, T39DE, S48T, V60I, K122E, D123G, I135T, K173A, Q174K, D177E, I178L, Q197P, T200R, Q207E, R211K, L228I  
>TC12_2004| codons 1-243
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALRAICEELEKEGKITKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DEGFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAKNPELVI
YQYVDDLYVGSDLEIGPHRRKIEELREHLLKWGFYTPDKKHQKEPPFIWMGYELHPDKWT
VQP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, L19I, M36I, R41K, H69K, L89M, I93L  
>TC12_2004| codons 1-99
PQITLWQRPLVTIKVGGQIKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Kassaye, S Envelope coreceptor tropism, drug resistance, and viral evolution among subtype C HIV-1-infected individuals receiving nonsuppressive antiretroviral therapy. JAIDS, 2009