<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TC-41 TC41_2004 Zimbabwe 2004 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 DDI 104
2 3TC+AZT+NVP 70
3 3TC+D4T+NVP 30

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, K70R, Y115F, Q151M, M184I A62V, V75I, F77L, F116Y, K219E Y181C   V35T, T39E, S68G, V118I, K122E, D123S, I142T, K173T, Q174K, T200A, Q207E, R211K, F214L, D218E  
>TC41_2004| codons 1-243
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICEEMEKEGKISKIGPENPYNTPV
FVIKRKDGTRWRKLIDLRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAFYSIPL
DESFRKYTAFTIPSINNETPGTRYQYNVLPMGWKGSPAIFQSSMTKILEPFRTKNPDIVI
CQYIDDLYVGSDLEIGQHRAKIEELREHLLKWGLTTPEEKHQKEPPFLWMGYELHPDKWT
VQP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, G17D, L19I, E35D, M36I, R41K, K45R, R57K, L63S, H69K, L89M, I93L  
>TC41_2004| codons 1-99
PQITLWQRPLVTIKVGDQIKEALLDTGADDTVLEDINLPGKWKPRMIGGIGGFIKVKQYD
QISIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Kassaye, S Envelope coreceptor tropism, drug resistance, and viral evolution among subtype C HIV-1-infected individuals receiving nonsuppressive antiretroviral therapy. JAIDS, 2009