<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TC-41 TC41_2003 Zimbabwe 2003 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 DDI 104
2 3TC+AZT+NVP 43

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R A62AV, K219KQ Y181YC   V35T, T39E, K103R, K122E, D123S, I142T, K173T, Q174K, T200A, Q207E, R211K, F214L  
>TC41_2003| codons 1-232
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICEEMEKEGKISKIGPENPYNTPV
FVIKRKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKRKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGTRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTKNPDIVI
CQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGLTTPDQKHQKEPPFLWMGY

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    W6WG, T12TP, I15V, L19LI, E35D, M36I, R41K, K45R, R57K, L63PS, H69K, L89M, I93L  
>TC41_2003| codons 1-99
PQITLGQRPLVPIKVGGQIKEALLDTGADDTVLEDINLPGKWKPRMIGGIGGFIKVKQYD
QISIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Kassaye, S Envelope coreceptor tropism, drug resistance, and viral evolution among subtype C HIV-1-infected individuals receiving nonsuppressive antiretroviral therapy. JAIDS, 2009
Johnston, E High frequency of syncytium-inducing and CXCR4-tropic viruses among human immunodeficiency virus type 1 subtype C-infected patients receiving antiretroviral treatment. J Virol, 2003