<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    F100FC, K111T, T124A, T125A, I135V, I203M S283G
>134| codons 1-288
FLDGIDKAQEEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAYCLLKLAGRWPVTTIHTDNGSN
FTSAAVKAACWWAGVKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDMIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVAGRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   R41K, D60E, I62V, L63P, I93L  
>134| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYE
QVPIEICGHKAIGTVLVGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E53ED, S68G, K122KQ, D123DE, D177E, G196E, R211G, V245E, A272P, V276I, L283LI, T286A, P294Q, Q334M, M357I, G359S, A371V, I375V, T377K, V381I, T403M, D460N, V467I, T470A, L491S, K512N, L517V, K558R  
>134| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPDNPYNTPV
FAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DQEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYMDDLYVGSDLEIEQHRTKIEELRQHLLGWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKIKQLCKLIRGAKALTEVIQLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGMGQWTYQIYQEPFKNLKTGKYARIRSA
HTNDVKQLTEVVQKVAKESIIIWGKTPKFKLPIQKETWEAWWMEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVISLADTTNQKTELQ
AIHLALQDSGSEVNIVTDSQYALGIIQAQPDNSESEVVSQIIEQLIKKEKVYLAWVPAHK
GIGGNEQVDKLVSAGIRRVL

References
Author Title Citation
Ibe, S Analysis of near full-length genomic sequences of drug-resistant HIV-1 spreading among therapy-naive individuals in Nagoya, Japan: Amino acid mutations associated with viral replication activity. ARHR, 2008