<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
655 655 Japan 2007 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
  T215DE     V35I, S68G, D123E, I135L, S162C, D177E, G196E, Q197QK, L210F, R211K  
>655| codons 1-236
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPEIVI
YQYMDDLYVGSDLEIEKHRTKIEELRQHLFKWGFETPDKKHQKEPPFLWMGYELHP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L10LFV I15V, G16GE, E35ED, N37NHRS, R41RK, I62V, L63T, I64IV, V77VL  
>655| codons 1-99
PQITLWQRPVVTIKVEGQLKEALLDTGADDTVLEDMSLPGKWKPKMIGGIGGFIKVRQYD
QVTVEICGHKAIGTVLLGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Fujisaki, S An 11-year surveillance of HIV type 1 subtypes in Nagoya, Japan. ARHR, 2009