<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
589 589 Japan 2007 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, I15V, E35D, M36I, R41K, R57K, Q61H, L89M  
>589| codons 1-99
PQITLWQRPLVTVKVGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
HILIEICGHKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6D, K20R, V35K, V60I, K122E, I135V, S162C, E169D, K173A, Q174K, D177E, V179I, Q207E, R211K  
>589| codons 1-236
PISPIDTVPVKLKPGMDGPRVKQWPLTEEKIKALKEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILDPFRAKNPEIII
YQYMDDLYVGSDLEIGQHRTKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHP

References
Author Title Citation
Fujisaki, S An 11-year surveillance of HIV type 1 subtypes in Nagoya, Japan. ARHR, 2009