<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 AZT 39
2 DDI 22
3 D4T+IDV 30
4 3TC+DDI+NFV 48
5 D4T+DDI+NVP 84
6 3TC+AZT+DDI+EFV 107
7 None 70
8 D4T+LPV+TDF 282
9 DRV+RAL+RTV+TDF 29

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    S119G, T122I, T125A, M154L, I203M, L234I, D256E  
>CA128616| codons 1-288
FLDGIDKAQEEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGGN
FISTAVKAACWWAGIKQEFGIPYNPQSQGVVESLNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDMIATDIQTKELQKQITKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSEIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   M36I, R57K, I62V, L63S, A71V, I93L  
>CA134388| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVKQYD
QVSIEICGHKVIGTVLVGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6D, A98S, K102Q, K122E, I135V, S162AT, E169D, T200I, K277R, T286A, E291D, E297A  
>CA134389| codons 1-302
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKQKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQTSMTKILDPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRIKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGAKALTDVIPLTAEAE
LE

References
Author Title Citation
Blanco, JL HIV-1 integrase inhibitor resistance and its clinical implications. J Infect Dis, 2011