<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 AZT 161
2 3TC+AZT+SQV 35
3 3TC+D4T+IDV 48
4 3TC+AZT+DLV+RTV+SQV 113
5 ABC+APV+DDI+EFV 152
6 ABC+APV+DDI+EFV+RTV 91
7 None 43
8 ABC+APV+EFV+RTV 28
9 AZT+LPV+TDF+TPV 41
10 3TC+AZT+DRV+RTV+T20+TDF 52
11 APV+FTC+RAL+T20+TDF 27

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    E11D, A21T, V77A, S119P, T122I, T125A, D232E, L234H  
>CA128612| codons 1-288
FLDGIDKAQEDHEKYHSNWRTMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAAHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGPN
FISTAVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSREPHWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I47V, I54V, L90M L23I, K43T, F53L L10I, E35D, L63P, I64V, A71V, T74S, I85V, I93L  
>CA95252| codons 1-99
PQITLWQRPIVTIKIGGQLKEAILDTGADDTVLEDMNLPGRWTPKLVGGIGGLVKVRQYD
QIPVEICGHKVIGSVLVGPTPVNIVGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184V, L210W, T215Y   L100I, K103N   V8I, S68G, V118I, K122E, I135T, V179I, T200I, H221Y, A272P, I293V, E297V  
>CA95253| codons 1-300
PISPIETIPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDGTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGIKKNKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIII
YQYVDDLYVGSDLEIGQHRIKIEELRQHLWRWGFYTPDKKYQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVVPLTVEAE

References
Author Title Citation
Blanco, JL HIV-1 integrase inhibitor resistance and its clinical implications. J Infect Dis, 2011