<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
K27580M1 08-101567 Uganda 2000 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L33F I13V, K14R, M36I, N37S, R41K, I62V, I64V, H69Y, I72V, V77I C67Q
>08-101567| codons 1-99
PQITLWQRPLVTVRIGGQLKEALLDTGADDTVFEEISLPGKWKPKMIGGIGGFIKVRQYD
QVLVEIQGYKAVGTVLIGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, S48T, K49R, V60I, V90I, K122E, D177E, T200I, Q207E, V245K, D250E, A272P, K277R, L282C, L283I, I293V, E297A  
>08-101567| codons 1-305
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKITRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYMDDLYVGSDLEIGQHRIKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKESWTVNDIQKLVGKLNWASQIYPGIKVRQLCKCIRGTKALTEVVPLTAEAE
LELAE

References
Author Title Citation
Eshleman, SH Antiretroviral drug susceptibility among drug-naive adults with recent HIV infection in Rakai, Uganda. AIDS, 2009