<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5242 CA12837 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 25
2 None 104
3 IDV+ D4T+ 3TC 104
4 None 20
5 DDI+ D4T+ NFV 47

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184MV N348I   V179D V118I, K122E, I135T, I142IV, T200A, F214L, K277R, I293V, I326T, R356K, T386I, K431KR, E432ED, R463RK, V466VA, T477TA, Q480QH, E492A, K527N, A554S, I556IV, K558KR A299AG
>CA12837| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIDI
YQYVDDLYVGSDLEIGQHRAKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGTKALTEVVPLTEEGE
LELAENREILKEPVHGVYYDPSKDLTAEIQKQGQGQWTYQIYQEPFKILKTGKYAKMRGA
HTNDVKQLTEAVQKIATESIVIWGKIPKFKLPIQKETWEAWWTEYWQATWIPEWEFVNTP
PLVKLWYQLERDPIVGAETFYVDGAANRETKLGKAGYVTDRGKQKAVSLTDTTNQKAELH
AIHLALQDSGLAVNIVTDSQYALGIIQAQPDKSESELVSQIIEQLINKEKVYLAWVPAHK
GIGGNEQVDKLVSSGVRRVL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46ML, I54V, V82A   I62V, L63P, I64V  
>CA12880| codons 14-99
KIGGQLKEALLDTGADDTVLEEMNLPGRWKPKLIGGIGGFVKVRQYDQVPVEICGHKAIG
TVLVGPTPANIIGRNLLTQIGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005