<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1317 CA12807 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDI NA
2 3TC+ AZT+ DDI NA
3 None 3
4 D4T+ DDI+ IDV 53
5 3TC+ AZT+ SQV 32

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
N88S, L90M L10F I15V, K20T, E35D, M36I, R41K, R57K, I62V, L63P, C67CY, A71AT, I93L  
>CA12807| codons 1-99
PQITLWQRPFVTIKVGGQLTEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
QVPIEIYGHKTIGTVLVGPTPVNIIGRSLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Y115F, Q151M, M184V V75I, F77L, F116Y     E40K, K46Q, K49R, I50V, T58N, S68G, K122E, Q174K, T200A, Q207E, R211K, K219T, V245T, E248D, D250E, S251D, A272P, K277R, T286A, A288S  
>CA12527| codons 1-291
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTKMEKEGQISRVGPENPYNNPV
FAIKKKDGTKWRKLIDLRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAFYSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSPAIFQSSMTKILEPFRKKNPDIVI
YQYVDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDTKHQKEPPFLWMGYELHPDKWT
VQPITLPDKEDWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKSLTE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005