<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5217 CA12804 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 108
2 AZT+ 3TC 100
3 D4T+ DDI+ NFV 110

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   K20KM, L63P, H69Q, T74S, V77I, I93L T4D
>CA12804| codons 1-99
PQIDLWQRPLVTIKIGGQLMEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGQKAIGSVLIGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210W, T215Y       K43KN, K104R, I142V, T200A, Q207E, R211K, L228H, T286A, I293IV, E297EK, K311KR, M357MIT, K366KR, T369TA, A376AT, T377TIM, K390KR, A400T, T403TA, E404ED, V435IT, A437AV, D460N, R461RK, V467I, H483HY, L491LS, A554ADNT, V559VI  
>CA12524| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELENEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKRSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLWKWGFYTPDKKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVVPLTKEAE
LELAENREILREPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARTRGA
HTNDVRQLAEAVQKITMESIVIWGKTPKFRLPIQKETWETWWADYWQATWIPEWEFVNTP
PLVKLWYQLEKEPITGVETFYVDGAANRETKLGKAGYVTNKGRQKVISLTDTTNQKTELQ
AIYLALQDSGSEVNIVTDSQYALGIIQAQPDKSESELVSQIIEQLIKKEKVYLAWVPAHK
GIGGNEQVDKLVSTGIRKIL

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001