<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4414 CA12784 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 12
2 AZT+ 3TC 9
3 DDI+ D4T+ NVP 24
4 D4T+ NVP 43
5 D4T+ EFV+ SQV 12
6 D4T+ EFV+ SQV 25
7 D4T+ 3TC+ ABC+ NFV+ APV 13

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12TA, I15LV, N37D, D60E, L63S G16GV
>CA12784| codons 10-99
LVAIKLVGQLKEALLDTGADDTVLEEMDLPGRWKPKMIGGIGGFIKVRQYEQISIEICGH
KAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K103N, Y181C P225PH T27S, K49R, V60VI, R83K, V90I, K102KR, D123E, I135LV, D177E, G196GE, R211K, A272P, K277R, I293V K281K*
>CA12507| codons 1-293
PISPIETVPVKLKPGMDGPKVKQWPLSEEKIKALVEICTEMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKKTQDFWEIQLGIPHPAGLKRNKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
CQYMDDLYVGSDLEIEQHRTKIEELRQHLLKWGFTTPDKKHQKEHPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLC*LLRGTKALTEVV

References
Author Title Citation
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005