<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
944-5 944-5 Cameroon 2004 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6D, V35T, T39K, E40D, V60I, K104KR, V118I, D121Y, K122E, T165I, F171Y, K173E, Q174R, D177E, D192DN, T200A, Q207E, R211K, F214L, V245Q, E248D, D250E, A272P, Q278H, K281R, T286A, E291D, V292I, I293V, T296TS, E297A, L301M, D324E, I329V, Q334L, G335D, Y339YD, F346Y, R356K, M357R, R358G, G359S, V365I, A371V, T386I, Q394R, A400V, K431T, V435L, F440Y, R461RK, R463K, V466I, V467I, S468A, D471E, T477A, Q480H, H483Q, L491S, K512R, S519N, V531I, A534S, A554S, V559I  
>944-5| codons 1-560
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALTEICKDMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKRSVTVLDVGDAYFSIPL
YEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMIKILEPYRERNPEIVI
YQYMDDLYVGSNLEIGQHRAKIEELREHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYPGIKVKHLCRLLRGAKALTDIVPLSAEAE
MELAENREILKEPVHGVYYDPSKELIAEVQKQGLDQWTDQIYQEPYKNLKTGKYAKRGSA
HTNDIKQLTEVVQKIATESIVIWGKIPKFKLPIRKETWEVWWTEYWQATWIPEWEFVNTP
PLVKLWYQLETEPILGAETYYVDGAANRETKLGKAGYVTDKGKQKIIALTETTNQKAELH
AIQLALQDSGSEVNIVTDSQYALGIIQAQPDRSESELVNQIIEQLIKKEKIYLSWVPAHK
GIGGNEQVDKLVSSGIRKIL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12K, I13V, K20I, M36I, R41K, C67S, H69K, K70R, V82I, L89M  
>944-5| codons 1-99
PQITLWQRPLVKVKIGGQLIEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QILIEISGKRAIGTVLVGPTPINIIGRNMLTQIGCTLNF

References
Author Title Citation
Yamaguchi, J HIV type 1 group M subtype G in Cameroon: Five genome sequences. ARHR, 2009