<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
515-28 515-28 Cameroon 2004 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10M, T12A, I13V, K14R, I15V, K20I, E35Q, M36I, R41K, R57K, Q61D, L63H, C67E, H69K, L89M  
>515-28| codons 1-99
PQITLWQRPMVAVRVGGQLIEALLDTGADDTVLEQINLPGKWKPKMIGGIGGFIKVKQYD
DIHIEIEGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K20R, V35T, T39N, V60I, K64KR, A98AS, D121H, K122E, I135IT, I142IT, K166KR, K173IT, Q174KR, D177E, I178L, T200A, Q207DEKN, R211RK, V245Q, E248D, D250E, A272Q, K277R, T286A, E291D, V292I, I293V, I329V, Q334L, G335D, F346Y, R356K, M357R, R358G, G359S, K366R, T386V, Q394R, A400L, E413D, K431T, V435VALS, F440Y, K454KR, R461K, R463K, V467I, S468T, L469I, T470Q, D471E, T477A, Q480H, H483Q, L491S, K512R, S519N, K527KN, K530R, V531VI, A534AT, A554S  
>515-28| codons 1-560
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICNEMEKEGKISKIGPENPYNTPI
FAIRKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSTNNETPGTRYQYNVLPQGWKGSPAIFQSSMTRILEPFRTRNPELVI
YQYMDDLYVGSDLEIGQHRAKIEELRNHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYQGIKVRQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEVQKQGLDQWTYQIYQEPYKNLKTGKYAKRGSA
HTNDVRQLTEAVQKIATESIVIWGKVPKFKLPIRKETWELWWTEYWQATWIPDWEFVNTP
PLVKLWYQLETEPISGAETYYVDGAANRETKLGRAGYVTDKGKQKVITIQETTNQKAELH
AIQLALQDSGSEVNIVTDSQYALGIIQAQPDRSESELVNQIIEQLINKERIYLTWVPAHK
GIGGNEQVDKLVSSGIRKVL

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    K14R, R20K, L101I, T112V, T124N, T125A, G134S, K136T, V201I, T206S, I208L, L234I, S255N, D256E R284G, D288N
>515-28| codons 1-288
FLDGIDKAQEEHERYHSNWKAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKVIHTDNGSN
FTSNAVKAACWWASITQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIASDLQTKELQKQITKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNNEIKVVPRRKAKIIRDYGKQMAGDDCVASGQDEN

References
Author Title Citation
Yamaguchi, J HIV type 1 group M subtype G in Cameroon: Five genome sequences. ARHR, 2009