<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
HSH2 H-SH2-W12 France 2007 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI+RTI NA
2 RAL 16

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
N155H   S17N, R20K, L28I, S39C, T124A, T125A, V201I, I208L  
>H-SH2-W12| codons 1-288
FLDGIDKAQEEHEKYHNNWKAMASDFNIPPVVAKEIVACCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSN
FTSAAVKAACWWAGIKQEFGIPYNPQSQGVVESMHKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDLQTKELQKQITKIQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED

References
Author Title Citation
Malet, I Mutations associated with failure of raltegravir treatment affect integrase sensitivity to the inhibitor in vitro. AAC, 2008