<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
1b H-SH1-W16 France 2008 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI+RTI 52
2 RAL 15

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
G140S, Q148H   E11D, A21T, D25E, S119G, T122I, T125A, V201I, I203M, T218S, L234I, D253E, D278E  
>H-SH1-W16| codons 1-288
FLDGIDKAQEDHEKYHSNWRTMASEFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGGN
FISTAVKAACWWAGIKQEFSIPYNPQSHGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDMIATDIQTKELQKQISKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQENSDIKVVPRRKAKIIRDYGKQMAGEDCVASRQDED

References
Author Title Citation
Malet, I Mutations associated with failure of raltegravir treatment affect integrase sensitivity to the inhibitor in vitro. AAC, 2008