<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
H6 H6-W20 France 2008 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI+RTI NA
2 RAL 20

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
N155H T97A, V151I E11D, V31I, L101I, K111T, I113V, S119T, T124N, T125A, S195C, A196P, A205T, T218S, D232N  
>H6-W20| codons 1-288
FLDGIDKAQEDHEKYHSNWRAMASDFNLPPIVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQEAAYFILKLAGRWPVTTVHTDNGTN
FTSNAVKAACWWAGIKQEFGIPYNPQSQGVIESMHKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYCPGERIVDIITTDIQTKELQKQISKIQNFRVYYRDSRNPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED

References
Author Title Citation
Malet, I Mutations associated with failure of raltegravir treatment affect integrase sensitivity to the inhibitor in vitro. AAC, 2008