<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 PI+RTI 48
2 RAL 29

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
E92Q, N155H   E11D, V31M, V32I, S39C, I72V, L101I, K111R, S119P, I135V, G193E, V201I, T218S  
>H2-W28| codons 1-287
FLDGIDKAQEDHEKYHSNWRAMASDFNLPPMIAKEIVACCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAQTGQETAYFILKLAGRWPVRTIHTDNGPN
FTSTTVKAACWWAGVKQEFGIPYNPQSQGVVESMHKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGEYSAGERIIDIIATDIQTKELQKQISKIQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDE

References
Author Title Citation
Malet, I Mutations associated with failure of raltegravir treatment affect integrase sensitivity to the inhibitor in vitro. AAC, 2008