<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 PI+RAL+RTI NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    E10A, E11D, S24N, I113V, S119SG, T122I, T124N, T125A, I220L  
>Pt18| codons 1-288
FLDGIDKAQADHEKYHSNWRAMANDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGGN
FISNAVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKLQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED

References
Author Title Citation
Garrido, C Dynamics in the selection of resistance mutations in HIV patients failing raltegravir and following its discontinuation. EUHIV DRW 2009, 2009