Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| CA5175 | CA12754 | U.S. | 1999 | HIV1 | B | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | AZT | 161 |
| 2 | 3TC+AZT | 44 |
| 3 | 3TC+AZT+IDV | 122 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| V32I, M46I, I47V, V82A | K43T | I13V, K14R, L63P, I64V |
| >CA12754| codons 1-99 PQITLWQRPLVTVRIGGQLKEALLDTGADDTILEEMNLPGRWTPKIVGGIGGFIKVRQYD QIPVEICGHKAIGTVLVGPTPANIIGRNLLTQIGCTLNF |
References
| Author | Title | Citation |
| Gonzales, MJ | HIV-1 reverse transcriptase and protease subtypes: classification, amino acid mutation patterns, and prevalence in a Northern California clinic-based population. | J Infect Dis, 2001 |
| Rhee, SY | HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. | J Infect Dis, 2005 |
| Rhee, SY | Predictive Value of HIV-1 Genotypic Resistance Test Interpretation Algorithms. | J Infect Dis, 2009 |