<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI+PI NA
2 NNRTI+NRTI+PI+RAL 52

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
  T97A, Y143S, S230R K14R, M22L, V32I, V37I, S39C, L101I, G163Q, V201I, D253E  
>pt5w48| codons 1-266
FLDGIDKAQEEHERYHSNWRALASDFNLPPVIAKEIIACCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQEAAYFILKLAGRWPVKTIHTDNGSN
FTSTTVKAACWWAGIKQEFGIPSNPQSQGVVESMNKELKKIIQQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTKELQKQITKIQNFRVYYRDRRDPLWKGPAK
LLWKGEGAVVIQENSDIKVVPRRKAK

References
Author Title Citation
Canducci, F Dynamic patterns of human immunodeficiency virus type 1 integrase gene evolution in patients failing raltegravir-based salvage therapies. AIDS, 2009