<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ABB125-98 ABB125-98 Cameroon 1998 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
  L74M K14R, K34R, L101I, T112I, T124A, T125A, G134N, I135V, K136T, V201I, T206S, Y227F, L234I, S255N, D256E, M275V S283G
>ABB125-98| codons 1-287
FLDGIDKAQEEHERYHSNWRAMASDFNLPPVVAREIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIIMVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKIIHTDNGSN
FTSAAVKAACWWANVTQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIASDIQTKELQKQITKIQNFRVYFRDSRDPIWKGPAK
LLWKGEGAVVIQDNNEIKVVPRRKAKIIRDYGKQVAGDDCVAGRQDE

References
Author Title Citation
Eshleman, SH Analysis of pol integrase sequences in diverse HIV type 1 strains using a prototype genotyping assay. ARHR, 2009