<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ABB102-97 ABB102-97 Cameroon 1997 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    K7R, K14R, V31I, M50I, Q95S, L101I, T112M, T124AG, T125A, K136Q, D167E, V201I, R224Q, L234I, W243X  
>ABB102-97| codons 1-248
FLDGIDRAQEEHERYHSNWRAMASDFNLPPIVAKEIVASCDKCQLKGEAIHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGSETAYFILKLAGRWPVKMIHTDNGSN
FTSGAVKAACWWAGIQQEFGIPYNPQSQGVVESMNKELKKIIGQVREQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTKELQKQITKIQNFQVYYRDSRDPIWKGPAK
LLXKGEGA

References
Author Title Citation
Eshleman, SH Analysis of pol integrase sequences in diverse HIV type 1 strains using a prototype genotyping assay. ARHR, 2009