<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ABB95-97 ABB95-97 Cameroon 1997 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    S17N, R20K, K71R, I84L, L101I, S119T, T124A, T125A, K136Q, D167E, V201I, T218I, L234V, D256E S283G
>ABB95-97| codons 1-288
FLDGIDKAQEEHEKYHNNWKAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGRIILVAVHVASGYLEAEVIPAETGQETAYFILKLAGRWPVKTIHTDNGTN
FTSAAVKAACWWAGIQQEFGIPYNPQSQGVVESMNKELKKIIGQVREQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTKELQKQIIKIQNFRVYYRDSRDPVWKGPAK
LLWKGEGAVVIQDNSEIKVVPRRKAKIIRDYGKQMAGDDCVAGRQDED

References
Author Title Citation
Eshleman, SH Analysis of pol integrase sequences in diverse HIV type 1 strains using a prototype genotyping assay. ARHR, 2009