<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ABB021-96 ABB021-96 Cameroon 1996 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
  T97TA D6S, E10ED, E13D, V32I, I72IV, L101I, T112V, I113V, T124TN, T125A, V126M, K160KR, G163GE, V201I, L234I, D279G R284G
>ABB021-96| codons 1-288
FLDGISKAQDEHDKYHSNWRAMASDFNLPPVIAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQEAAYFILKLAGRWPVKVVHTDNGSN
FTSNAMKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKRIIEQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTKELQKQITKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDGCVASGQDED

References
Author Title Citation
Eshleman, SH Analysis of pol integrase sequences in diverse HIV type 1 strains using a prototype genotyping assay. ARHR, 2009